PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g52260.1.p
Common NameBRADI_3g52260, LOC100833183
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 306aa    MW: 33375.2 Da    PI: 4.7176
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g52260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-181663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT++Ed +lv +++++G ++W++ +r  g+ R++k+c++rw +yl
  Bradi3g52260.1.p 16 RGSWTPQEDMRLVAYIQKHGHPNWRALPRQAGLLRCGKSCRLRWINYL 63
                      89******************************99************97 PP

2Myb_DNA-binding53.26.8e-1769114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+eE+e  ++++++lG++ W++Ia+ ++ gRt++++k+ w+++l
  Bradi3g52260.1.p  69 RGNFTAEEEETVIKLHALLGNK-WSKIAASLP-GRTDNEIKNVWNTHL 114
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-22766IPR009057Homeodomain-like
PROSITE profilePS5129414.8191163IPR017930Myb domain
SuperFamilySSF466892.17E-2913110IPR009057Homeodomain-like
SMARTSM007176.5E-131565IPR001005SANT/Myb domain
PfamPF002494.1E-151663IPR001005SANT/Myb domain
CDDcd001679.56E-101863No hitNo description
PROSITE profilePS5129426.18264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2667117IPR009057Homeodomain-like
SMARTSM007172.5E-1468116IPR001005SANT/Myb domain
PfamPF002491.8E-1569114IPR001005SANT/Myb domain
CDDcd001671.40E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLVAY IQKHGHPNWR ALPRQAGLLR CGKSCRLRWI  60
NYLRPDLRRG NFTAEEEETV IKLHALLGNK WSKIAASLPG RTDNEIKNVW NTHLKKKASP  120
KKKEHQQQEK PGAAKNNAAN GDSDPASSSS ASSSTTSNEP EDMIDISEAL LEALKDKEAF  180
PEAAPMSMSS CSSSSSLTTT YASGGVEELL ELPEIDMDEN IWSIIDDDDF AADRPQGDAT  240
VPCAAIAAGQ GEEEGKEWWL EDLEKELGLW GPTEELQAFV GPMTEGDPVC SYFQSRPTTP  300
ASNSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794371e-127HF679437.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB31 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572844.10.0PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-111MYB1_MAIZE; Myb-related protein Zm1
TrEMBLI1ICT90.0I1ICT9_BRADI; Uncharacterized protein
STRINGBRADI3G52260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.16e-68myb domain protein 63